Cathaypacific.com receives about 5711978 visitors in one month. That could possibly earn $28559.89 each month or $952 each day. Server of the website is located in Sweden. It took our server 4.02 seconds to reach and load the main page of Cathaypacific.com. This does not include JavaScript, image and CSS files load timing. This is a good result. This result is good enough, but there is a room for improvement. If you would like to investigate please refer to the link at the bottom of this page.
Is cathaypacific.com legit? | |
Website Value | $514079 |
Alexa Rank | 5418 |
Monthly Visits | 5711978 |
Daily Visits | 190400 |
Monthly Earnings | $28559.89 |
Daily Earnings | $952 |
Country: Sweden
Metropolitan Area: Stockholm
Postal Reference Code: 173 11
Latitude: 59.3333
Longitude: 18.05
HTML Tag | Content | Informative? |
---|---|---|
Title: | Online Flight Booking | Airfare | Hong Kong - Cathay | Could be improved |
Description: | Book flights to Singapore, London, Bangkok, Osaka and other destinations with Cathay Pacific. You can also manage bookings and view your frequent flyer account |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for cathaypacific.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto cathaypacific.com
Alexa - cathaypacific.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on cathaypacific.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to cathaypacific.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from cathaypacific.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 5.189.207.161 IP
View a list of websites with an IP matching that of cathaypacific.com from Bing.com
Similar domain names
charyebate.comupdate-manualcathaypacific.onlinecathaypacific.reviewscathaypacifica.comcathaypacific.co.jpcathaypacifci.comcathaypacif.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...