Fantasycricketnews.com receives about 2769 visitors in one month. That could possibly earn $13.85 each month or $0.46 each day. Server of the website is located in the United States. Fantasycricketnews.com main page was reached and loaded in 0.16 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is fantasycricketnews.com legit? | |
Website Value | $250 |
Alexa Rank | 1689981 |
Monthly Visits | 2769 |
Daily Visits | 93 |
Monthly Earnings | $13.85 |
Daily Earnings | $0.46 |
Country: United States
Metropolitan Area: Scottsdale
Postal Reference Code: 85260
Latitude: 33.6013
Longitude: -111.8867
HTML Tag | Content | Informative? |
---|---|---|
Title: | Fantasy Cricket News & Information | Dream11 Lineups | DFC | IPL | Could be improved |
Description: | Fantasy Cricket News is your go-to place for fantasy cricket news and information. Keep current on the latest cricket news, IPL 2018 previews, odds and injury updates, and DFC and Dream11 fantasy team | |
H1: | Is it informative enough? | |
H2: | Asia Cup Match 6 – Afghanistan V Bangladesh – FCN Preview | |
H3: | Featured News | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for fantasycricketnews.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto fantasycricketnews.com
Alexa - fantasycricketnews.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on fantasycricketnews.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to fantasycricketnews.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from fantasycricketnews.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 198.71.233.214 IP
View a list of websites with an IP matching that of fantasycricketnews.com from Bing.com
/comments/feed/: | |
---|---|
Title |
Comments for Daily Fantasy Cricket News and Information |
Description |
Not defined |
/category/news/: | |
---|---|
Title |
News Archives | Daily Fantasy Cricket News and Information |
Description |
Not defined |
H2 |
Virat Kohli is No. 1 in ODI Batsman Rankings! |
H3 |
Like FCN |
/category/fantasy-previews/: | |
---|---|
Title |
Fantasy Previews Archives | Daily Fantasy Cricket News and Information |
Description |
Not defined |
H2 |
4th Test – South Africa vs Australia – Fantasy Preview |
H3 |
Like FCN |
/category/entertainment/: | |
---|---|
Title |
Entertainment Archives | Daily Fantasy Cricket News and Information |
Description |
Not defined |
H2 |
David Warner wants to shake hand with Joe Root at Walkabout bar |
H3 |
Like FCN |
/category/cricket-fun/: | |
---|---|
Title |
Cricket Fun Archives | Daily Fantasy Cricket News and Information |
Description |
Not defined |
H2 |
MS Dhoni Rates Shoaib Akhtar as Toughest Bowler He Faced |
H3 |
Like FCN |
Similar domain names
fantasycricketonline.comfantasycrickets.comfantasycricketstar.comfantasycricketmatches.netfantasycricketlive.comfantasycricketleagues.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...