Minecraftskins.net receives about 2284724 visitors in one month. That could possibly earn $11423.62 each month or $380.79 each day. Server of the website is located in the United States. Minecraftskins.net main page was reached and loaded in 0.22 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is minecraftskins.net legit? | |
Website Value | $205626 |
Alexa Rank | 34224 |
Monthly Visits | 2284724 |
Daily Visits | 76158 |
Monthly Earnings | $11423.62 |
Daily Earnings | $380.79 |
Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822
HTML Tag | Content | Informative? |
---|---|---|
Title: | Minecraft Skins | best Minecraft | Could be improved |
Description: | A selection of high quality minecraft skins available for free Create your own skins with our online | |
H1: | Is it informative enough? | |
H2: | James Raynor | Is it informative enough? |
H3: | Designed by Caleb | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for minecraftskins.net
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto minecraftskins.net
Alexa - minecraftskins.net on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on minecraftskins.net
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to minecraftskins.net.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from minecraftskins.net have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 104.20.227.20 IP
View a list of websites with an IP matching that of minecraftskins.net from Bing.com
Similar domain names
moroccogt.comupdate-manualminecraftskins.partyminecraftskins4u.comminecraftskins4u.netminecraftskins.infominecraftskins.comminecraftskins.biz
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...