Myfitnesspal.com receives about 26776827 visitors in one month. That could possibly earn $133884.14 each month or $4462.8 each day. Server of the website is located in the United Kingdom. It took our server 4.12 seconds to reach and load the main page of Myfitnesspal.com. This does not include JavaScript, image and CSS files load timing. This is a good result. This result is good enough, but there is a room for improvement. If you would like to investigate please refer to the link at the bottom of this page.
Is myfitnesspal.com legit? | |
Website Value | $2409915 |
Alexa Rank | 1150 |
Monthly Visits | 26776827 |
Daily Visits | 892561 |
Monthly Earnings | $133884.14 |
Daily Earnings | $4462.8 |
Country: United Kingdom
Metropolitan Area: Lenzie
Postal Reference Code: G66
Latitude: 55.9276
Longitude: -4.154
HTML Tag | Content | Informative? |
---|---|---|
Title: | Free Calorie Counter, Diet & Exercise Journal | | Could be improved |
Description: | Free online calorie counter and diet plan. Lose weight by tracking your caloric intake quickly and easily. Find nutrition facts for over 2,000,000 | |
H1: | Calorie Counter | Is it informative enough? |
H2: | Lose Weight with MyFitnessPal | Is it informative enough? |
H3: | Lose weight the healthy way | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for myfitnesspal.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto myfitnesspal.com
Alexa - myfitnesspal.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on myfitnesspal.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to myfitnesspal.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from myfitnesspal.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 95.85.80.44 IP
View a list of websites with an IP matching that of myfitnesspal.com from Bing.com
Similar domain names
moroccogt.comupdate-manualmyfitnesspal.com.brmyfitnesspal.com.mxmyfitnesspal.demyfitnesspack.netmyfitnessover40.commyfitnessover40.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...