Refinedads.com receives about 1135404 visitors in one month. That could possibly earn $5677.02 each month or $189.23 each day. Server of the website is located in the United States. It took our server 2.47 seconds to reach and load the main page of Refinedads.com. This does not include JavaScript, image and CSS files load timing. This is a good result. This result is good enough, but there is a room for improvement. If you would like to investigate please refer to the link at the bottom of this page.
Traffic and Value
| Is refinedads.com legit? | |
| Website Value | $102187 |
| Alexa Rank | 464894 |
| Monthly Visits | 1135404 |
| Daily Visits | 37847 |
| Monthly Earnings | $5677.02 |
| Daily Earnings | $189.23 |
Refinedads.com Server Location
Country: United States
Metropolitan Area: Ashburn
Postal Reference Code: 20149
Latitude: 39.0481
Longitude: -77.4728
Summarized Content
Refinedads Main Page Content
| HTML Tag | Content | Informative? |
|---|---|---|
| Title: | Nielsen Visual IQ – Der führende Marketing Intelligence | Could be improved |
| Description: | Der Marktführer im Bereich Marketing Intelligence, Nielsen Visual IQ, verbindet die Stärken von Audience und Attribution, so dass Sie die Marketing-Performance nach Zielgruppensegmenten verstehen |  |
| H1: | Ein Problem der Marketing Performance - oder eher eine Herausforderung des Messens und Bewertens? | |
| H2: | Refined Labs is now | Is it informative enough? |
| H3: | Strategische Messung | Is it informative enough? |
We've noticed that you have issues with some content elements on the main page:
• Title contains 67 characters. We think that you could improve this tag by adding more relevant information or keywords.
• Take a look at the headings; there might be too little information. Headings are important for usability and search engine optimization.
Other Helpful Websites and Services for Refinedads
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for refinedads.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto refinedads.com
Alexa - refinedads.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on refinedads.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to refinedads.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from refinedads.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 54.156.200.55 IP
View a list of websites with an IP matching that of refinedads.com from Bing.com
Internal Pages
| /images/icons/apple-touch-icon.png: | |
|---|---|
| Title |
Nielsen Visual IQ – Der führende Marketing Intelligence Provider |
| Description |
Der Marktführer im Bereich Marketing Intelligence, Nielsen Visual IQ, verbindet die Stärken von Audience und Attribution, so d Sie die Marketing-Performance nach Zielgruppensegmenten verstehen können. [censored]
|
| H1 |
Ein Problem der Marketing Performance - oder eher eine Herausforderung des Messens und Bewertens? |
| H2 |
Refined Labs is now |
| H3 |
Strategische Messung |
Similar domain names
refinedadventurahub.comrefinedaerial.comrefinedagency.reviewrefinedaccessories.comrefinedacc.comrefinedacc.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Stop charging my account or police and better business bureau will be notified
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...